English to Malagasy Meaning :: subject

Subject :
foto-kevitra
- foto-kevitrafoto-kevitranampanaikynampanekenyhanaikylohahevitra
 
Facebook Twitter Linkedin Gmail Share More

Show English Meaning
(+)

Subjacent

Show Examples
(+)

(1) The metal content of the fluids thus reflects the trace-element composition of the subjacent source rocks which, in mid-ocean ridges, are basaltic.(2) The cause of crater formation can be envisaged as the subsidence of a structurally bound Triassic layer into a subjacent Zechstein succession, which was extending and thinning.(3) Viral antigen extended, in a time-dependent fashion, from nasal epithelium into the subjacent lamina propria and along olfactory nerves in cells interpreted to be perineural fibroblasts.(4) Recent studies proposed that the Cretan detachment is a shallowly north-dipping normal fault, which formed subparallel to the subjacent subduction thrust in the Early Miocene.(5) At 187 m, a thin bed of iron-stained quartz sandstone drapes across an irregular surface cut into oolitic dolomitic grainstones that represent the latest phase of the subjacent shallowing record.(6) Further evidence in favour of the variable analysis comes from the fact that the distribution of null objects is sensitive to subjacency .(7) In this paper, we take a similar approach to one of the classic linguistic universals: subjacency .
Synonyms
1. Subject
  
2. Capable
  
3. Open
  
4. Dependent
  
5. Topic
  
6. Theme
  
7. Issue
  
8. Matter
  
9. Discipline
  
10. Subject area
  
11. Subject field
  
12. Field
  
13. Field of study
  
14. Study
  
15. Bailiwick
  
16. Branch of knowledge
  
17. Content
  
18. Depicted object
  
19. Case
  
20. Guinea pig
  
21. National
  
22. Subjugate
  
23. Submit
  
24. Accountable
  
25. Apt
  
26. Captive
  
27. Collateral
  
28. Conditional
  
29. Contingent
  
30. Controlled
  
31. Directed
  
32. Disposed
  
33. Enslaved
  
34. Exposed
  
35. Governed
  
36. Inferior
  
37. Liable
  
38. Likely
  
39. Obedient
  
40. Prone
  
41. Provisional
  
42. Ruled
  
43. Satellite
  
44. Secondary
  
45. Sensitive
  
46. Servile
  
47. Slavish
  
48. Sub
  
49. Subaltern
  
50. Subjugated
  
51. Submissive
  
52. Subordinate
  
53. Subservient
  
54. Susceptible
  
55. Tentative
  
56. Tributary
  
57. Under
  
58. Vulnerable
  
59. Affair
  
60. Argument
  
61. Business
  
62. Chapter
  
63. Class
  
64. Core
  
65. Course
  
66. Discussion
  
67. Gist
  
68. Head
  
69. Idea
  
70. Item
  
71. Material
  
72. Meat
  
73. Motif
  
74. Motion
  
75. Motive
  
76. Object
  
77. Point
  
78. Problem
  
79. Proposal
  
80. Question
  
81. Resolution
  
82. Subject matter
  
83. Substance
  
84. Text
  
85. Theorem
  
86. Thesis
  
87. Thought
  
88. Client
  
89. Customer
  
90. Liege
  
91. Patient
  
92. Serf
  
93. Vassal
  
Word Example from TV Shows

The best way to learn proper English is to read news report, and watch news on TV. Watching TV shows is a great way to learn casual English, slang words, understand culture reference and humor. If you have already watched these shows then you may recall the words used in the following dialogs.

Now, can we please change the subject?

Now, can we please change the SUBJECT?

The Big Bang Theory Season 6, Episode 1


Wrong is an absolute state
and not subject to gradation.

Wrong is an absolute state and not SUBJECT to gradation.

The Big Bang Theory Season 2, Episode 20


Don\'t look down if you\'re subject
to vertigo... and use their stairwell.

Don't look down if you're SUBJECT to vertigo... and use their stairwell.

The Big Bang Theory Season 1, Episode 14


I don\'t imagine
thinking about that subject

I don't imagine thinking about that SUBJECT

Game of Thrones Season 8, Episode 4


Listen, on another subject,
I just wanted to tell you

Listen, on another SUBJECT, I just wanted to tell you

Breaking Bad Season 4, Episode 9


English to Malagasy Dictionary: subject

Meaning and definitions of subject, translation in Malagasy language for subject with similar and opposite words. Also find spoken pronunciation of subject in Malagasy and in English language.

Tags for the entry 'subject'

What subject means in Malagasy, subject meaning in Malagasy, subject definition, examples and pronunciation of subject in Malagasy language.

Malagasy.English-Dictionary.Help | English to Malagasy Dictionary

This is not just an ordinary English to Malagasy dictionary & Malagasy to English dictionary. This dictionary has the largest database for word meaning. It does not only give you English toMalagasy and Malagasy to English word meaning, it provides English to English word meaning along with Antonyms, Synonyms, Examples, Related words and Examples from your favorite TV Shows. This dictionary helps you to search quickly for Malagasy to English translation, English to Malagasy translation. It has more than 500,000 word meaning and is still growing. This English to Malagasy dictionary also provides you an Android application for your offline use. The dictionary has mainly three features : translate English words to Malagasy translate Malagasy words to English, copy & paste any paragraph in the Read Text box then tap on any word to get instant word meaning. This website also provides you English Grammar, TOEFL and most common words.
Learn Prepositions by Photos
Commonly confused words
form of verbs
Learn 300+ TOEFL words
Fill in the blanks
Topic Wise Words
Learn 3000+ common words
Words Everyday
Most Searched Words
GRE words
Android App
iPhone App
Chrome Extension

Blog List

Topic Wise Words

Learn 3000+ Common Words

Learn Common GRE Words

Learn Words Everyday

Your Favorite Words
Currently you do not have any favorite word. To make a word favorite you have to click on the heart button.
Your Search History
All Dictionary Links