English to Malagasy Meaning of impact - fiantraikany


Impact :
fiantraikany

fiantraikany, hery miasa mangina, fahefana, fahatsapana, voankazo, vokatra, vokatr'izany, mitsoka, ratsy, voa, ratra, fifandirana, midona amin-, siny, dondony, daroka, nibedy, fandevilevena, iharan'izany, aretina, fifandonan'ny planeta, fifaninanana, krizy, fandokafana, Rhythm, androm, Atoseho, Rap

fiantraikany

fiantraikanyfiantraikanyimpactingfiantraikan'ny
Facebook Twitter Linkedin Share More
Definitions of impact in English
Noun(1) the striking of one body against another(2) a forceful consequence; a strong effect(3) influencing strongly(4) the violent interaction of individuals or groups entering into combat
Verb(1) press or wedge together; pack together(2) have an effect upon
Examples of impact in English
(1) Basically, due to the internal injuries from the impact , bile had contaminated the entire body cavity, making it smell foul.(2) Several factors inherent to contemporary economics also impact adversely on the prospects for teaching Marxism.(3) Each of these planks has an enormous negative environmental impact and, at best, mixed economic impacts.(4) Two weeks before the draft, almost everyone looks like a potential impact player.(5) With residue, the raindrop impact is absorbed and erosion is reduced.(6) The introduction of these foreign organisms can have a devastating impact on marine environments.(7) She said the impact of the smash knocked the door off its hinges.(8) it was caused by an impact to his head(9) To trust someone involves taking a risk, as you are letting someone else impact what happens to you.(10) European-style regulations of information collection would have a tremendous negative economic impact .(11) there was the sound of a third impact(12) The findings of a health impact assessment are often limited by financial and time costs.(13) A fellow council worker, who had just got out of the vehicle and was standing close at the time of the impact , suffered serious injuries.(14) Firstly, let me reassure you, I've read your victim impact statements.(15) Women are often disregarded in decision-making and camp management, even when the decisions directly impact their daily lives.(16) Early detection, treatment and intervention are essential to minimize the long-term negative impact of maternal depression.
Related Phrases of impact
(1) impact on ::
fiantraikany eo amin'ny
(2) impact factor ::
fiantraikany antony
(3) adverse impact ::
manana ady fiantraikany
(4) impact resistance ::
fiantraikany fanoherana
(5) social impact ::
fiantraikany ara-tsosialy
(6) impact strength ::
fiantraikany hery
(7) immediate impact ::
fiantraikany avy hatrany
(8) direct impact ::
fiantraikany mivantana
(9) impact force ::
fiantraikany force
(10) impact printer ::
fiantraikany pirinty
Synonyms
Noun
1. collision ::
fifandonan'ny planeta
2. effect ::
vokatry
3. shock ::
dona
5. wallop ::
wallop
Verb
6. crash into ::
fianjerana ho
7. affect ::
vokany eo
8. bear upon ::
Mijoro amin '
Antonyms
1. dislodge ::
dislodge
2. uproot ::
hongotako
Different Forms
impact, impacted, impacting, impacts
Word Example from TV Shows
Growing up, the movies
had such an impact on my life.

Growing up, the movies had such an IMPACT on my life.

The Big Bang Theory Season 8, Episode 19

but you've clearly
had an impact on him.

but you've clearly had an IMPACT on him.

The Big Bang Theory Season 7, Episode 11

This is a sub-sonic impact sensor.

This is a sub-sonic IMPACT sensor.

The Big Bang Theory Season 1, Episode 11

The impact breaks them right apart.

The IMPACT breaks them right apart.

Game of Thrones Season 4, Episode 7

Well, Roswell Correctional's
pretty low impact, you know.

Well, Roswell Correctional's pretty low IMPACT, you know.

Breaking Bad Season 3, Episode 12

English to Malagasy Dictionary: impact

Meaning and definitions of impact, translation in Malagasy language for impact with similar and opposite words. Also find spoken pronunciation of impact in Malagasy and in English language.

Tags for the entry 'impact'

What impact means in Malagasy, impact meaning in Malagasy, impact definition, examples and pronunciation of impact in Malagasy language.

Learn Prepositions by Photos
Commonly confused words
form of verbs
Learn 300+ TOEFL words
Fill in the blanks
Topic Wise Words
Learn 3000+ common words
Words Everyday
Most Searched Words
GRE words
Android App
iPhone App
Chrome Extension

Blog List

Topic Wise Words

Learn 3000+ Common Words

Learn Common GRE Words

Learn Words Everyday

Your Favorite Words
Currently you do not have any favorite word. To make a word favorite you have to click on the heart button.
Your Search History